PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr032804.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRAS
Protein Properties Length: 459aa    MW: 51370.3 Da    PI: 5.0108
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr032804.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS308.21.9e-94664543374
         GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNq 100
                  +lL+ecA+avs++d +++++lL+ l+elasp+gd  q+la+yf++AL  + ++s+ ++yk+l++ ++++++ +++ +    f+evsP+ +f+h++ N 
  Pbr032804.1  66 RLLMECARAVSEKDSSKINHLLWMLNELASPYGDCEQKLAFYFLQALFCKATESGVRCYKTLTSVAEKSHSFDSARKLILKFQEVSPWTTFGHVASNG 163
                  79************************************************************9999985554444444445***************** PP

         GRAS 101 aIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvl.vakrledleleeLrvk 197
                  aIlea+ege+++HiiD++ + ++QWp+Ll+aLa+R++++p+l++T+v+  +s  k  ++e+g+r++kfA+ +gvpfe+nv+   ++l +l+ e+L v+
  Pbr032804.1 164 AILEALEGETKLHIIDISNTICTQWPTLLEALATRNDETPHLKLTVVVT-ASIVKSVMKEIGQRMEKFARLMGVPFEINVIsGLNNLGELTKEDLGVQ 260
                  *************************************************.66799*************************95567************* PP

         GRAS 198 pgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadh.nse...sFlerflealeyysalfdsleaklpreseerikvErellg 291
                  ++Ea+aVn++ +l r+      +e+ r +v+++++sl+P+vv+vve+ead+ +s+   +F++ f e+l++y+  fd+le+++ ++s+er ++Ere  +
  Pbr032804.1 261 EDEAVAVNCIGALRRVE-----VEE-RGAVIRMFQSLRPRVVTVVEEEADLfSSSvnhDFVKCFEECLRFYTLYFDMLEESFVPTSNERLMLERE-CS 351
                  ***************97.....444.88********************99965546669************************************.89 PP

         GRAS 292 reivnvvacegaerr........erhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrve........ee......sgslvlgWkdrpL 367
                  r+iv v+ c + ++         er+e+ ++W++rl+ a F+pv++s+++++++k+ll+++   g+ +         e       +  ++l+Wk++p+
  Pbr032804.1 352 RSIVRVLGCDHHDHDddknggecERRERGSQWSDRLKVA-FSPVRFSDDVVDDVKALLKRYR-AGWALVlppplgggEGggddidQTGIYLTWKEEPV 447
                  *********99876433344444899**********866.**********************.777777556665551155566588888******** PP

         GRAS 368 vsvSaWr 374
                  v++S W+
  Pbr032804.1 448 VWASIWK 454
                  ******8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098545.25938421IPR005202Transcription factor GRAS
PfamPF035146.7E-9266454IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 459 aa     Download sequence    Send to blast
MDISLFSPNK EANFLQQYSN QIKINGLAAA IDMQSTNQQP QNSHTSTSRS WGSSEPCPEG  60
AKWASRLLME CARAVSEKDS SKINHLLWML NELASPYGDC EQKLAFYFLQ ALFCKATESG  120
VRCYKTLTSV AEKSHSFDSA RKLILKFQEV SPWTTFGHVA SNGAILEALE GETKLHIIDI  180
SNTICTQWPT LLEALATRND ETPHLKLTVV VTASIVKSVM KEIGQRMEKF ARLMGVPFEI  240
NVISGLNNLG ELTKEDLGVQ EDEAVAVNCI GALRRVEVEE RGAVIRMFQS LRPRVVTVVE  300
EEADLFSSSV NHDFVKCFEE CLRFYTLYFD MLEESFVPTS NERLMLEREC SRSIVRVLGC  360
DHHDHDDDKN GGECERRERG SQWSDRLKVA FSPVRFSDDV VDDVKALLKR YRAGWALVLP  420
PPLGGGEGGG DDIDQTGIYL TWKEEPVVWA SIWKPSAG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-31684548375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009341163.10.0PREDICTED: protein SHORT-ROOT-like
SwissprotQ9SZF71e-145SHR_ARATH; Protein SHORT-ROOT
TrEMBLM5XBH60.0M5XBH6_PRUPE; Uncharacterized protein
STRINGPOPTR_0017s05450.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF129734106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37650.11e-135GRAS family protein